PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00024516-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family EIL
Protein Properties Length: 439aa    MW: 49264.2 Da    PI: 5.3458
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00024516-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3148.77.8e-46411481111
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         eel+krmwkd+++lkr+ker+k  +   ++a++++k + +++ a+rkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++
  WALNUT_00024516-RA  41 EELEKRMWKDRVRLKRIKERQKLVV---QQAADKQKPKSTTDLAQRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGASDNI 128
                         8********************9765...44599********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXX CS
                EIN3  92 raWWkekvefdrngpaaisk 111
                         raWWkek     ng+  +++
  WALNUT_00024516-RA 129 RAWWKEKQPSSDNGTSGVTD 148
                         ********999999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.7E-4441148No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MEQHLMMVDD TLGYSSDIEV DDIRCENIAE KDVSDEEIEA EELEKRMWKD RVRLKRIKER  60
QKLVVQQAAD KQKPKSTTDL AQRKKMSRAQ DGILKYMLKL MEVCKARGFV YGIIPEKGKP  120
VSGASDNIRA WWKEKQPSSD NGTSGVTDLR RGGHGGNKRA AISSESDYDV DGVGDGVGSV  180
SSKDGRRNQP TDVETSDNQH NTTPVQDKDT GEKRNGRKRG RFRSKFVDQL PATSHNEDPH  240
IEPRITVPHV NHTEGQLVGF QTHGDRQEDD TMTDLRPLEK NIGQLQLPAS ESNHFSSLPS  300
ENVVSTQSMH VDGRPLLYPV VQNTERHHGN AGNFYSPSVQ YGNTHDWQQS QIRPEEVGVH  360
AATSDRSGNE IPVGDLHYYV KDTFNNEQHQ HIDPQFGSAI DSLSLDCGGL NSPFDFGIDG  420
ISQFDDLLRD EDLIQYFGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015867129.11e-126PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0B2RFK81e-133A0A0B2RFK8_GLYSO; ETHYLENE INSENSITIVE 3-like 3 protein
STRINGVIT_06s0004g01610.t017e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1820556
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.12e-57ETHYLENE-INSENSITIVE3-like 3